Lot #260122LL103

Price range: $40.00 through $102.00
Price range: $40.00 through $80.00

Endogenous Human Antimicrobial Cathelicidin

LL-37 [5mg]

5mg / vial

Cathelicidin peptide

≥99% HPLC

4.9 / 5

Trusted by 5,000+ researchers

30-day money back

2-day shipping

Signed COA on every batch

Secure checkout

Price range: $40.00 through $102.00
Price range: $40.00 through $80.00

COA on Every Batch

BioRegen Verified

≥99% HPLC Purity

Made in the USA

2-Day Shipping

30-Day Money Back

Compound Profile

Researcher-grade specs. No guesswork.

Each vial ships with structural data and lot identifiers for the compound, plus a Certificate of Analysis documenting purity and identity. Ready for the bench. Synthesized via solid-phase peptide synthesis (SPPS), purified by reverse-phase HPLC, verified by mass spectrometry, and tested for sterility and endotoxin load. Every spec is documented on the signed Certificate of Analysis that ships with your vial.

— Component 01
LL-37 · 5mg
Class
Cathelicidin antimicrobial peptide
Sequence
[LL-37, 37 aa]
CAS Number
154947-66-7
Molecular Formula
C₂₀₅H₃₄₀N₆₀O₅₃S
Molecular Weight
4,493.3 g/mol
Per-component purity
≥ 99%
Form
Lyophilized white powder, single vial
Identity (LC-MS)
All confirmed
Sterility / LAL
PASS
Storage
2-8°C, sealed, dry
Origin
Made in the USA
In the Literature

One compound. One research record.

LL-37 is the sole human cathelicidin, generated in vivo by proteolytic cleavage of the precursor protein hCAP-18 by the serine protease proteinase 3. The 37-amino acid C-terminal fragment — named for its two N-terminal leucine residues — was first characterized by Birgitta Agerberth, Gudmundur H. Gudmundsson, and colleagues at the Karolinska Institutet in Stockholm in the mid-1990s. It forms an amphipathic alpha-helix in membrane-mimetic environments.

Preclinical investigation has covered direct antimicrobial activity against gram-positive and gram-negative organisms, disruption of bacterial biofilm architecture, modulation of cytokine and chemokine signaling, neutrophil and dendritic cell responses, and wound closure dynamics in murine models. A landmark 2002 study by Scott, Davidson, Bowdish, and Hancock at the University of British Columbia demonstrated that LL-37 functions as a multifunctional modulator of innate immune signaling in vitro. All findings referenced here derive from preclinical models and have not been validated in controlled human clinical trials.

LL-37 has been cited in Journal of Immunology, Frontiers in Immunology, Antimicrobial Agents and Chemotherapy, and PNAS. It is not approved by the U.S. Food and Drug Administration for any diagnostic, therapeutic, or preventive application. It is classified as a research compound only.

For research use only. Statements above describe published research literature and do not constitute health, medical, or therapeutic claims for either compound or for the blend. Not for human or veterinary use. Not evaluated by the FDA.

Documented Research Areas

  • Gram-positive and gram-negative antimicrobial membrane disruption
  • Bacterial biofilm inhibition and eradication in in vitro models
  • Innate immune cytokine and chemokine modulation
  • Neutrophil, monocyte, and dendritic cell response characterization
  • Murine wound-infection bacterial load reduction
  • Vitamin D-regulated CAMP gene expression and host defense signaling

Selected Studies · Peer-Reviewed Literature

A curated list of published peer-reviewed papers indexed in PubMed where BPC-157 has been studied. Provided for research-context only. Linking to the literature does not constitute endorsement of any therapeutic application.

01

Scott MG, et al. (2002) · Journal of Immunology

The Human Antimicrobial Peptide LL-37 Is a Multifunctional Modulator of Innate Immune Responses

PubMed · PubMed · 12244186
02

Laskowski DA, et al. (2013) · Frontiers in Immunology

The Human Cathelicidin Antimicrobial Peptide LL-37 as a Potential Treatment for Polymicrobial Infected Wounds

PubMed · PMC · 3699762

Compound database reference for chemical and structural data:

Transparency

Every lot. Every researcher. Same proof.

Each batch ships with a third-party Certificate of Analysis from BioRegen Analytical. HPLC purity, mass-spectrometry identity, sterility, and LAL endotoxin screening. Every test, every lot.

Your lot number ships on the label and on the COA. Enter it in the verifier any time to retrieve the original lab report.

Verify Batch COA

Certificate of Analysis

CompoundLL-37 (hCAP-18 C-Terminal Fragment)
CAS#154947-66-7
FormulaC₂₀₅H₃₄₀N₆₀O₅₃
Mol. Weight4,493.3 g/mol
Identity (LC-MS)PASS · [m/z from COA]
Purity (HPLC)[purity % from COA]
Retention Time[retention time from COA]
Sterility / LALPASS
Date TestedOn file

Pairs With

Related compounds.

Other research peptides in the Elixser catalog cited alongside the BPC-157 + TB-500 blend in the published research literature.

GLP-3 [20mg]

10mg / single compound

Research use only · Not for human or veterinary use

$80.00

SS-31 [30mg]

10mg / single compound

Research use only · Not for human or veterinary use

Price range: $75.00 through $191.25
Price range: $75.00 through $80.00

KPV [10mg]

10mg / single compound

Research use only · Not for human or veterinary use

Price range: $40.00 through $102.00
Price range: $40.00 through $80.00

Common Questions

Answered straight.

Ready to Order

Add the LL-37 [5mg] blend to your research arsenal.

5,000+ researchers trust Elixser for batch-tested peptides. Every vial. Every COA. Every time.

30-day money back · Free shipping over $150 · 2-day shipping

Signed COA on every batch